Recombinant Human F5 protein, His-SUMO-tagged
| Cat.No. : | F5-2879H |
| Product Overview : | Recombinant Human F5 protein(P12259)(1490-1614aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1490-1614aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.4 kDa |
| AA Sequence : | MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | F5 coagulation factor V (proaccelerin, labile factor) [ Homo sapiens ] |
| Official Symbol | F5 |
| Synonyms | F5; coagulation factor V (proaccelerin, labile factor); coagulation factor V; factor V Leiden; proaccelerin, labile factor; activated protein c cofactor; coagulation factor V jinjiang A2 domain; FVL; PCCF; THPH2; |
| Gene ID | 2153 |
| mRNA Refseq | NM_000130 |
| Protein Refseq | NP_000121 |
| MIM | 612309 |
| UniProt ID | P12259 |
| ◆ Recombinant Proteins | ||
| F5-768H | Recombinant Human F5 protein, His-tagged | +Inquiry |
| F5-769M | Recombinant Mouse F5 protein, His-tagged | +Inquiry |
| F5-765C | Recombinant Cattle F5 protein, His & T7-tagged | +Inquiry |
| F5-767H | Recombinant Human F5 protein, His-tagged | +Inquiry |
| F5-772P | Recombinant Pig F5 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
| F5-284B | Active Native Bovine Factor V | +Inquiry |
| F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
| F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F5 Products
Required fields are marked with *
My Review for All F5 Products
Required fields are marked with *
