Recombinant Human FAAH, GST-tagged
Cat.No. : | FAAH-26642TH |
Product Overview : | Recombinant Human FAAH(480 a.a. - 579 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVAL PWQEELCLRFMREVERLMTPEKQSS |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80oC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAAH fatty acid amide hydrolase [ Homo sapiens (human) ] |
Official Symbol | FAAH |
Synonyms | FAAH; fatty acid amide hydrolase; fatty-acid amide hydrolase 1; FAAH 1; oleamide hydrolase 1; anandamide amidohydrolase 1; FAAH-1; MGC102823; MGC138146 |
Gene ID | 2166 |
mRNA Refseq | NM_001441 |
Protein Refseq | NP_001432 |
MIM | 602935 |
UniProt ID | O00519 |
Chromosome Location | 1p35-p34 |
Pathway | Retrograde endocannabinoid signaling; anandamide degradation |
Function | acylglycerol lipase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity |
◆ Recombinant Proteins | ||
FAAH-1840R | Recombinant Rat FAAH Protein, His (Fc)-Avi-tagged | +Inquiry |
FAAH-621H | Recombinant Human FAAH | +Inquiry |
RFL28695RF | Recombinant Full Length Rat Fatty-Acid Amide Hydrolase 1(Faah) Protein, His-Tagged | +Inquiry |
FAAH-7192HFL | Recombinant Full Length Human FAAH, Flag-tagged | +Inquiry |
Faah-1002M | Recombinant Mouse Faah Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAAH Products
Required fields are marked with *
My Review for All FAAH Products
Required fields are marked with *