Recombinant Human FAAH, GST-tagged

Cat.No. : FAAH-26642TH
Product Overview : Recombinant Human FAAH(480 a.a. - 579 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide.
Molecular Mass : 36.74 kDa
AA Sequence : DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVAL PWQEELCLRFMREVERLMTPEKQSS
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80oC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAAH fatty acid amide hydrolase [ Homo sapiens (human) ]
Official Symbol FAAH
Synonyms FAAH; fatty acid amide hydrolase; fatty-acid amide hydrolase 1; FAAH 1; oleamide hydrolase 1; anandamide amidohydrolase 1; FAAH-1; MGC102823; MGC138146
Gene ID 2166
mRNA Refseq NM_001441
Protein Refseq NP_001432
MIM 602935
UniProt ID O00519
Chromosome Location 1p35-p34
Pathway Retrograde endocannabinoid signaling; anandamide degradation
Function acylglycerol lipase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAAH Products

Required fields are marked with *

My Review for All FAAH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon