Recombinant Human FAAP24 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FAAP24-1309H |
| Product Overview : | C19orf40 MS Standard C13 and N15-labeled recombinant protein (NP_689479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | FAAP24 is a component of the Fanconi anemia (FA) core complex, which plays a crucial role in DNA damage response. |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FAAP24 FA core complex associated protein 24 [ Homo sapiens (human) ] |
| Official Symbol | FAAP24 |
| Synonyms | FAAP24; FA core complex associated protein 24; C19orf40; Fanconi anemia core complex-associated protein 24; Fanconi anemia core complex associated protein 24; Fanconi anemia-associated protein of 24 kDa |
| Gene ID | 91442 |
| mRNA Refseq | NM_152266 |
| Protein Refseq | NP_689479 |
| MIM | 610884 |
| UniProt ID | Q9BTP7 |
| ◆ Recombinant Proteins | ||
| Faap24-192M | Recombinant Mouse Faap24 Protein, MYC/DDK-tagged | +Inquiry |
| FAAP24-1309H | Recombinant Human FAAP24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FAAP24-952H | Recombinant Human FAAP24 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAAP24 Products
Required fields are marked with *
My Review for All FAAP24 Products
Required fields are marked with *
