Recombinant Human FAAP24 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAAP24-1309H
Product Overview : C19orf40 MS Standard C13 and N15-labeled recombinant protein (NP_689479) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAAP24 is a component of the Fanconi anemia (FA) core complex, which plays a crucial role in DNA damage response.
Molecular Mass : 23.7 kDa
AA Sequence : MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAAP24 FA core complex associated protein 24 [ Homo sapiens (human) ]
Official Symbol FAAP24
Synonyms FAAP24; FA core complex associated protein 24; C19orf40; Fanconi anemia core complex-associated protein 24; Fanconi anemia core complex associated protein 24; Fanconi anemia-associated protein of 24 kDa
Gene ID 91442
mRNA Refseq NM_152266
Protein Refseq NP_689479
MIM 610884
UniProt ID Q9BTP7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAAP24 Products

Required fields are marked with *

My Review for All FAAP24 Products

Required fields are marked with *

0
cart-icon