Recombinant Human FABP2 Protein, GST-tagged
Cat.No. : | FABP2-3631H |
Product Overview : | Human FABP2 full-length ORF (1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017] |
Molecular Mass : | 34.32 kDa |
AA Sequence : | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGINSQSKNQALFETLKLFLNLVSPLITT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FABP2 fatty acid binding protein 2, intestinal [ Homo sapiens ] |
Official Symbol | FABP2 |
Synonyms | FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132; |
Gene ID | 2169 |
mRNA Refseq | NM_000134 |
Protein Refseq | NP_000125 |
MIM | 134640 |
UniProt ID | P12104 |
◆ Recombinant Proteins | ||
FABP2-3697H | Recombinant Human FABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FABP2-4610HFL | Recombinant Full Length Human FABP2 protein, Flag-tagged | +Inquiry |
FABP2-2807P | Recombinant Pig FABP2 protein, His & T7-tagged | +Inquiry |
FABP2-1797C | Recombinant Chicken FABP2 | +Inquiry |
FABP2-248H | Recombinant Human FABP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP2-6478HCL | Recombinant Human FABP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FABP2 Products
Required fields are marked with *
My Review for All FABP2 Products
Required fields are marked with *
0
Inquiry Basket