Recombinant Human FABP3 protein, GST-tagged
Cat.No. : | FABP3-12632H |
Product Overview : | Recombinant Human FABP3 protein(1-133 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-133 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [ Homo sapiens ] |
Official Symbol | FABP3 |
Synonyms | FABP3; fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor); FABP11, fatty acid binding protein 11 , MDGI; fatty acid-binding protein, heart; H FABP; O FABP; fatty acid binding protein 11; mammary-derived growth inhibitor; muscle fatty acid-binding protein; Fatty acid-binding protein 3, muscle; heart-type fatty acid-binding protein; MDGI; FABP11; H-FABP; M-FABP; O-FABP; |
mRNA Refseq | NM_004102 |
Protein Refseq | NP_004093 |
MIM | 134651 |
UniProt ID | P05413 |
Gene ID | 2170 |
◆ Recombinant Proteins | ||
FABP3-3633H | Recombinant Human FABP3 Protein, His-tagged | +Inquiry |
FABP3-2927M | Recombinant Mouse FABP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP3-3549HFL | Recombinant Full Length Human FABP3 protein, Flag-tagged | +Inquiry |
FABP3-6927H | Recombinant Human FABP3 protein | +Inquiry |
FABP3-363M | Recombinant Mouse FABP3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP3 Products
Required fields are marked with *
My Review for All FABP3 Products
Required fields are marked with *