Recombinant Human FABP3 protein, GST-tagged

Cat.No. : FABP3-12632H
Product Overview : Recombinant Human FABP3 protein(1-133 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-133 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [ Homo sapiens ]
Official Symbol FABP3
Synonyms FABP3; fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor); FABP11, fatty acid binding protein 11 , MDGI; fatty acid-binding protein, heart; H FABP; O FABP; fatty acid binding protein 11; mammary-derived growth inhibitor; muscle fatty acid-binding protein; Fatty acid-binding protein 3, muscle; heart-type fatty acid-binding protein; MDGI; FABP11; H-FABP; M-FABP; O-FABP;
mRNA Refseq NM_004102
Protein Refseq NP_004093
MIM 134651
UniProt ID P05413
Gene ID 2170

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP3 Products

Required fields are marked with *

My Review for All FABP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon