Recombinant Human FABP3 protein, GST-tagged
| Cat.No. : | FABP3-12632H |
| Product Overview : | Recombinant Human FABP3 protein(1-133 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-133 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [ Homo sapiens ] |
| Official Symbol | FABP3 |
| Synonyms | FABP3; fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor); FABP11, fatty acid binding protein 11 , MDGI; fatty acid-binding protein, heart; H FABP; O FABP; fatty acid binding protein 11; mammary-derived growth inhibitor; muscle fatty acid-binding protein; Fatty acid-binding protein 3, muscle; heart-type fatty acid-binding protein; MDGI; FABP11; H-FABP; M-FABP; O-FABP; |
| mRNA Refseq | NM_004102 |
| Protein Refseq | NP_004093 |
| MIM | 134651 |
| UniProt ID | P05413 |
| Gene ID | 2170 |
| ◆ Recombinant Proteins | ||
| FABP3-5424M | Recombinant Mouse FABP3 Protein | +Inquiry |
| Fabp3-5861R | Recombinant Rat Fabp3 protein, His-tagged | +Inquiry |
| FABP3-9427Z | Recombinant Zebrafish FABP3 | +Inquiry |
| FABP3-0007H | Recombinant Human FABP3 Protein | +Inquiry |
| FABP3-653H | Recombinant Human FABP3 protein, MYC/DDK-tagged, C13/N15-labeled | +Inquiry |
| ◆ Native Proteins | ||
| FABP3-42H | Native Human FABP3 | +Inquiry |
| FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
| FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
| FABP3-10R | Native Rat FABP3 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP3 Products
Required fields are marked with *
My Review for All FABP3 Products
Required fields are marked with *
