Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FABP5-3366H |
Product Overview : | FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus. |
Molecular Mass : | 15.2 kDa |
AA Sequence : | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FABP5 fatty acid binding protein 5 [ Homo sapiens (human) ] |
Official Symbol | FABP5 |
Synonyms | FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP; |
Gene ID | 2171 |
mRNA Refseq | NM_001444 |
Protein Refseq | NP_001435 |
MIM | 605168 |
UniProt ID | Q01469 |
◆ Recombinant Proteins | ||
FABP5-3366H | Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FABP5-2928M | Recombinant Mouse FABP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP5-269H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
FABP5-001H | Recombinant Human Fatty Acid Binding Protein 5, His tagged | +Inquiry |
FABP5-2188R | Recombinant Rat FABP5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP5-6476HCL | Recombinant Human FABP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP5 Products
Required fields are marked with *
My Review for All FABP5 Products
Required fields are marked with *
0
Inquiry Basket