Recombinant Human FABP6 protein, GST-tagged
| Cat.No. : | FABP6-12636H |
| Product Overview : | Recombinant Human FABP6 protein(1-128 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-128 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FABP6 fatty acid binding protein 6, ileal [ Homo sapiens ] |
| Official Symbol | FABP6 |
| Synonyms | FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB; |
| Gene ID | 2172 |
| mRNA Refseq | NM_001040442 |
| Protein Refseq | NP_001035532 |
| MIM | 600422 |
| UniProt ID | P51161 |
| ◆ Recombinant Proteins | ||
| FABP6-484P | Recombinant Pig FABP6 Protein, His-tagged | +Inquiry |
| Fabp6-485R | Recombinant Rat Fabp6 Protein, His/GST-tagged | +Inquiry |
| FABP6-6928H | Recombinant Human FABP6 protein(Met1-Ala128) | +Inquiry |
| FABP6-2830H | Recombinant Human FABP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FABP6-28736TH | Recombinant Human FABP6 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FABP6-6475HCL | Recombinant Human FABP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP6 Products
Required fields are marked with *
My Review for All FABP6 Products
Required fields are marked with *
