Recombinant Human FABP6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FABP6-2830H
Product Overview : FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene.
Molecular Mass : 14.4 kDa
AA Sequence : MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FABP6 fatty acid binding protein 6 [ Homo sapiens (human) ]
Official Symbol FABP6
Synonyms FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB;
Gene ID 2172
mRNA Refseq NM_001445
Protein Refseq NP_001436
MIM 600422
UniProt ID P51161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP6 Products

Required fields are marked with *

My Review for All FABP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon