Recombinant Human FABP6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FABP6-2830H |
Product Overview : | FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FABP6 fatty acid binding protein 6 [ Homo sapiens (human) ] |
Official Symbol | FABP6 |
Synonyms | FABP6; fatty acid binding protein 6, ileal; gastrotropin; I 15P; I BABP; I BALB; I BAP; ILBP; ILBP3; ileal bile acid binding protein; ILLBP; illeal lipid binding protein; GT; intestinal 15 kDa protein; ileal lipid-binding protein; illeal lipid-binding protein; I-15P; I-BAP; I-BABP; I-BALB; |
Gene ID | 2172 |
mRNA Refseq | NM_001445 |
Protein Refseq | NP_001436 |
MIM | 600422 |
UniProt ID | P51161 |
◆ Recombinant Proteins | ||
FABP6-4425HF | Recombinant Full Length Human FABP6 Protein, GST-tagged | +Inquiry |
FABP6-919C | Recombinant Cattle FABP6 Protein, His&GST-tagged | +Inquiry |
FABP6-3676H | Recombinant Human FABP6 Protein, His-tagged | +Inquiry |
Fabp6-2904M | Recombinant Mouse Fabp6 Protein, Myc/DDK-tagged | +Inquiry |
FABP6-5073C | Recombinant Chicken FABP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP6-6475HCL | Recombinant Human FABP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP6 Products
Required fields are marked with *
My Review for All FABP6 Products
Required fields are marked with *