Recombinant Human FADD protein, His-tagged
Cat.No. : | FADD-6463H |
Product Overview : | Recombinant Human FADD protein(Q13158)(1-208aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-208a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
Gene Name | FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ] |
Official Symbol | FADD |
Synonyms | FADD; Fas (TNFRSF6)-associated via death domain; protein FADD; Fas associating death domain containing protein; Fas associating protein with death domain; GIG3; growth inhibiting gene 3 protein; mediator of receptor induced toxicity; MORT1; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; MGC8528; |
Gene ID | 8772 |
mRNA Refseq | NM_003824 |
Protein Refseq | NP_003815 |
MIM | 602457 |
UniProt ID | Q13158 |
◆ Recombinant Proteins | ||
FADD-885H | Recombinant Human FADD Protein, His (Fc)-Avi-tagged | +Inquiry |
FADD-805H | Recombinant Human FADD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FADD-382H | Recombinant Human FADD protein, GST-tagged | +Inquiry |
fadD-3693E | Recombinant Escherichia coli (strain K12) fadD protein, His-tagged | +Inquiry |
Fadd-1743M | Recombinant Mouse Fadd protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FADD-6473HCL | Recombinant Human FADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADD Products
Required fields are marked with *
My Review for All FADD Products
Required fields are marked with *