Recombinant Human FADD protein, His-tagged
| Cat.No. : | FADD-6463H | 
| Product Overview : | Recombinant Human FADD protein(1-208 aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-208 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AASequence : | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ] | 
| Official Symbol | FADD | 
| Synonyms | FADD; Fas (TNFRSF6)-associated via death domain; protein FADD; Fas associating death domain containing protein; Fas associating protein with death domain; GIG3; growth inhibiting gene 3 protein; mediator of receptor induced toxicity; MORT1; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; MGC8528; | 
| Gene ID | 8772 | 
| mRNA Refseq | NM_003824 | 
| Protein Refseq | NP_003815 | 
| MIM | 602457 | 
| UniProt ID | Q13158 | 
| ◆ Recombinant Proteins | ||
| FADD-2352E | Recombinant Escherichia coli FADD Protein (1-561 aa), His-tagged | +Inquiry | 
| FADD-3640H | Recombinant Human FADD Protein, GST-tagged | +Inquiry | 
| FADD-885H | Recombinant Human FADD Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FADD-382H | Recombinant Human FADD protein, GST-tagged | +Inquiry | 
| FADD-805H | Recombinant Human FADD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FADD-6473HCL | Recombinant Human FADD 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADD Products
Required fields are marked with *
My Review for All FADD Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            