Recombinant Human FAH, GST-tagged
Cat.No. : | FAH-86H |
Product Overview : | Recombinant Human FAH(1 a.a. - 419 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). |
Molecular Mass : | 72.8 kDa |
AA Sequence : | MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSFMGLGQ AAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIMFRDKENALMP NWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHI FGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLS VNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDL GNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAH fumarylacetoacetate hydrolase (fumarylacetoacetase) [ Homo sapiens (human) ] |
Official Symbol | FAH |
Synonyms | FAH; fumarylacetoacetate hydrolase (fumarylacetoacetase); fumarylacetoacetase; FAA; beta-diketonase; FLJ51912 |
Gene ID | 2184 |
mRNA Refseq | NM_000137 |
Protein Refseq | NP_000128 |
MIM | 613871 |
UniProt ID | P16930 |
Chromosome Location | 15q25.1 |
Pathway | Metabolism of amino acids and derivatives; Phenylalanine and tyrosine catabolism; Tyrosine degradation, tyrosine => homogentisate |
Function | fumarylacetoacetase activity; metal ion binding |
◆ Recombinant Proteins | ||
FAH-1631H | Recombinant Human FAH protein, His-tagged | +Inquiry |
FAH-7111HFL | Recombinant Full Length Human FAH, Flag-tagged | +Inquiry |
FAH-2197R | Recombinant Rat FAH Protein | +Inquiry |
FAH-1368R | Recombinant Rhesus Macaque FAH Protein, His (Fc)-Avi-tagged | +Inquiry |
FAH-2312H | Recombinant Human FAH Protein (Ser2-Ser419), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAH-6469HCL | Recombinant Human FAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAH Products
Required fields are marked with *
My Review for All FAH Products
Required fields are marked with *