Recombinant Human FAHD2A Protein, GST-tagged
Cat.No. : | FAHD2A-3652H |
Product Overview : | Human FAHD2A full-length ORF ( AAH09403.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAHD2A (Fumarylacetoacetate Hydrolase Domain Containing 2A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is FAHD2B. |
Molecular Mass : | 61 kDa |
AA Sequence : | MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAHD2A fumarylacetoacetate hydrolase domain containing 2A [ Homo sapiens ] |
Official Symbol | FAHD2A |
Synonyms | FAHD2A; fumarylacetoacetate hydrolase domain containing 2A; fumarylacetoacetate hydrolase domain-containing protein 2A; CGI 105; fumarylacetoacetate hydrolase domain containing 1; CGI-105; FLJ35661; MGC131995; |
Gene ID | 51011 |
mRNA Refseq | NM_016044 |
Protein Refseq | NP_057128 |
UniProt ID | Q96GK7 |
◆ Recombinant Proteins | ||
FAHD2A-2199R | Recombinant Rat FAHD2A Protein | +Inquiry |
FAHD2A-6679H | Recombinant Human FAHD2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAHD2A-3652H | Recombinant Human FAHD2A Protein, GST-tagged | +Inquiry |
FAHD2A-4440HF | Recombinant Full Length Human FAHD2A Protein, GST-tagged | +Inquiry |
FAHD2A-1856R | Recombinant Rat FAHD2A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAHD2A-6468HCL | Recombinant Human FAHD2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAHD2A Products
Required fields are marked with *
My Review for All FAHD2A Products
Required fields are marked with *