Recombinant Human FAHD2A Protein, GST-tagged

• Cat.No.: FAHD2A-3652H
• Product Overview: Human FAHD2A full-length ORF ( AAH09403.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAHD2A (Fumarylacetoacetate Hydrolase Domain Containing 2A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is FAHD2B.
• Molecular Mass: 61 kDa
• AA Sequence: MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAHD2A fumarylacetoacetate hydrolase domain containing 2A [ Homo sapiens ]
• Official Symbol: FAHD2A
• Synonyms: FAHD2A; fumarylacetoacetate hydrolase domain containing 2A; fumarylacetoacetate hydrolase domain-containing protein 2A; CGI 105; fumarylacetoacetate hydrolase domain containing 1; CGI-105; FLJ35661; MGC131995
• Gene ID: 51011
• mRNA Refseq: NM_016044
• Protein Refseq: NP_057128
• UniProt ID: Q96GK7