Recombinant Human FAM102B Protein, GST-tagged
Cat.No. : | FAM102B-3663H |
Product Overview : | Human FAM102B full-length ORF ( NP_001010883.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM102B (Family With Sequence Similarity 102 Member B) is a Protein Coding gene. An important paralog of this gene is FAM102A. |
Molecular Mass : | 62 kDa |
AA Sequence : | MRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM102B family with sequence similarity 102, member B [ Homo sapiens ] |
Official Symbol | FAM102B |
Synonyms | FAM102B; family with sequence similarity 102, member B; protein FAM102B; DKFZp779B126; DKFZp686N01110; |
Gene ID | 284611 |
mRNA Refseq | NM_001010883 |
Protein Refseq | NP_001010883 |
UniProt ID | Q5T8I3 |
◆ Recombinant Proteins | ||
FAM102B-1549R | Recombinant Rhesus monkey FAM102B Protein, His-tagged | +Inquiry |
FAM102B-1140H | Recombinant Human FAM102B Protein, His-tagged | +Inquiry |
FAM102B-4452HF | Recombinant Full Length Human FAM102B Protein, GST-tagged | +Inquiry |
FAM102B-1374R | Recombinant Rhesus Macaque FAM102B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM102B-3663H | Recombinant Human FAM102B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM102B-6463HCL | Recombinant Human FAM102B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM102B Products
Required fields are marked with *
My Review for All FAM102B Products
Required fields are marked with *
0
Inquiry Basket