Recombinant Human FAM102B Protein, GST-tagged

Cat.No. : FAM102B-3663H
Product Overview : Human FAM102B full-length ORF ( NP_001010883.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM102B (Family With Sequence Similarity 102 Member B) is a Protein Coding gene. An important paralog of this gene is FAM102A.
Molecular Mass : 62 kDa
AA Sequence : MRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM102B family with sequence similarity 102, member B [ Homo sapiens ]
Official Symbol FAM102B
Synonyms FAM102B; family with sequence similarity 102, member B; protein FAM102B; DKFZp779B126; DKFZp686N01110;
Gene ID 284611
mRNA Refseq NM_001010883
Protein Refseq NP_001010883
UniProt ID Q5T8I3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM102B Products

Required fields are marked with *

My Review for All FAM102B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon