Recombinant Human FAM107A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM107A-3729H
• Product Overview: FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Neuroblastoma and Brain Cancer. An important paralog of this gene is FAM107B.
• Molecular Mass: 17.5 kDa
• AA Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEERELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM107A family with sequence similarity 107 member A [ Homo sapiens (human) ]
• Official Symbol: FAM107A
• Synonyms: FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473
• Gene ID: 11170
• mRNA Refseq: NM_007177
• Protein Refseq: NP_009108
• MIM: 608295
• UniProt ID: O95990