Recombinant Human FAM107A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM107A-3729H |
Product Overview : | FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Neuroblastoma and Brain Cancer. An important paralog of this gene is FAM107B. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEERELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM107A family with sequence similarity 107 member A [ Homo sapiens (human) ] |
Official Symbol | FAM107A |
Synonyms | FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473; |
Gene ID | 11170 |
mRNA Refseq | NM_007177 |
Protein Refseq | NP_009108 |
MIM | 608295 |
UniProt ID | O95990 |
◆ Recombinant Proteins | ||
Fam107a-2909M | Recombinant Mouse Fam107a Protein, Myc/DDK-tagged | +Inquiry |
FAM107A-12652H | Recombinant Human FAM107A, His-tagged | +Inquiry |
FAM107A-1137H | Recombinant Human FAM107A Protein, MYC/DDK-tagged | +Inquiry |
FAM107A-3729H | Recombinant Human FAM107A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM107A-1554R | Recombinant Rhesus monkey FAM107A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM107A-581HCL | Recombinant Human FAM107A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM107A Products
Required fields are marked with *
My Review for All FAM107A Products
Required fields are marked with *