Recombinant Human FAM107A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM107A-3729H
Product Overview : FAM107A MS Standard C13 and N15-labeled recombinant protein (NP_009108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM107A (Family With Sequence Similarity 107 Member A) is a Protein Coding gene. Diseases associated with FAM107A include Neuroblastoma and Brain Cancer. An important paralog of this gene is FAM107B.
Molecular Mass : 17.5 kDa
AA Sequence : MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEERELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM107A family with sequence similarity 107 member A [ Homo sapiens (human) ]
Official Symbol FAM107A
Synonyms FAM107A; family with sequence similarity 107, member A; protein FAM107A; DRR1; TU3A; down-regulated in renal cell carcinoma 1; family with sequence similarity 107 member A transcript; FLJ30158; FLJ45473;
Gene ID 11170
mRNA Refseq NM_007177
Protein Refseq NP_009108
MIM 608295
UniProt ID O95990

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM107A Products

Required fields are marked with *

My Review for All FAM107A Products

Required fields are marked with *

0
cart-icon