Recombinant Human FAM109A Protein, GST-tagged
| Cat.No. : | FAM109A-3671H |
| Product Overview : | Human FAM109A full-length ORF ( NP_653272.2, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Molecular Mass : | 53.6 kDa |
| AA Sequence : | MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM109A family with sequence similarity 109, member A [ Homo sapiens ] |
| Official Symbol | FAM109A |
| Synonyms | FAM109A; family with sequence similarity 109, member A; sesquipedalian-1; FLJ32356; protein FAM109A; 27 kDa inositol polyphosphate phosphatase-interacting protein A; SES1; IPIP27A; |
| Gene ID | 144717 |
| mRNA Refseq | NM_001177996 |
| Protein Refseq | NP_001171467 |
| MIM | 614239 |
| UniProt ID | Q8N4B1 |
| ◆ Recombinant Proteins | ||
| FAM109A-4465HF | Recombinant Full Length Human FAM109A Protein, GST-tagged | +Inquiry |
| FAM109A-3671H | Recombinant Human FAM109A Protein, GST-tagged | +Inquiry |
| FAM109A-2953M | Recombinant Mouse FAM109A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM109A-5456M | Recombinant Mouse FAM109A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM109A-6457HCL | Recombinant Human FAM109A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM109A Products
Required fields are marked with *
My Review for All FAM109A Products
Required fields are marked with *



