Recombinant Full Length Human FAM109A Protein, GST-tagged

Cat.No. : FAM109A-4465HF
Product Overview : Human FAM109A full-length ORF ( NP_653272.2, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 249 amino acids
Description : This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Molecular Mass : 53.6 kDa
AA Sequence : MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM109A family with sequence similarity 109, member A [ Homo sapiens ]
Official Symbol FAM109A
Synonyms FAM109A; family with sequence similarity 109, member A; sesquipedalian-1; FLJ32356; protein FAM109A; 27 kDa inositol polyphosphate phosphatase-interacting protein A; SES1; IPIP27A;
Gene ID 144717
mRNA Refseq NM_001177996
Protein Refseq NP_001171467
MIM 614239
UniProt ID Q8N4B1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM109A Products

Required fields are marked with *

My Review for All FAM109A Products

Required fields are marked with *

0
cart-icon