Recombinant Human FAM117B Protein, GST-tagged
Cat.No. : | FAM117B-3684H |
Product Overview : | Human FAM117B full-length ORF (BAC04700.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM117B (Family With Sequence Similarity 117 Member B) is a Protein Coding gene. An important paralog of this gene is GLCCI1. |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQLKEIAKLRQQLQRSKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLTISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM117B family with sequence similarity 117, member B [ Homo sapiens ] |
Official Symbol | FAM117B |
Synonyms | ALS2CR13; FAM117B; family with sequence similarity 117, member B |
Gene ID | 150864 |
mRNA Refseq | NM_173511 |
Protein Refseq | NP_775782 |
UniProt ID | Q6P1L5 |
◆ Recombinant Proteins | ||
FAM117B-4485HF | Recombinant Full Length Human FAM117B Protein, GST-tagged | +Inquiry |
FAM117B-5470M | Recombinant Mouse FAM117B Protein | +Inquiry |
FAM117B-3684H | Recombinant Human FAM117B Protein, GST-tagged | +Inquiry |
FAM117B-12659H | Recombinant Human FAM117B, GST-tagged | +Inquiry |
FAM117B-2967M | Recombinant Mouse FAM117B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM117B Products
Required fields are marked with *
My Review for All FAM117B Products
Required fields are marked with *
0
Inquiry Basket