Recombinant Human FAM117B Protein, GST-tagged

Cat.No. : FAM117B-3684H
Product Overview : Human FAM117B full-length ORF (BAC04700.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM117B (Family With Sequence Similarity 117 Member B) is a Protein Coding gene. An important paralog of this gene is GLCCI1.
Molecular Mass : 64.2 kDa
AA Sequence : MRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQLKEIAKLRQQLQRSKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLTISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAEG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM117B family with sequence similarity 117, member B [ Homo sapiens ]
Official Symbol FAM117B
Synonyms ALS2CR13; FAM117B; family with sequence similarity 117, member B
Gene ID 150864
mRNA Refseq NM_173511
Protein Refseq NP_775782
UniProt ID Q6P1L5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM117B Products

Required fields are marked with *

My Review for All FAM117B Products

Required fields are marked with *

0
cart-icon
0
compare icon