Recombinant Human FAM122B protein, His-tagged
Cat.No. : | FAM122B-3616H |
Product Overview : | Recombinant Human FAM122B protein(1 - 180 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVPSPRRFSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM122B family with sequence similarity 122B [ Homo sapiens ] |
Official Symbol | FAM122B |
Synonyms | FAM122B; family with sequence similarity 122B; protein FAM122B; DKFZp686L20116; RP11 308B5.5; synoviocyte proliferation associated in collagen-induced arthritis 2; SPACIA2; RP11-308B5.5; MGC131814; |
Gene ID | 159090 |
mRNA Refseq | NM_001166599 |
Protein Refseq | NP_001160071 |
UniProt ID | Q7Z309 |
◆ Recombinant Proteins | ||
FAM122B-3690H | Recombinant Human FAM122B Protein, GST-tagged | +Inquiry |
FAM122B-3544H | Recombinant Human FAM122B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM122B-912Z | Recombinant Zebrafish FAM122B | +Inquiry |
Fam122b-2914M | Recombinant Mouse Fam122b Protein, Myc/DDK-tagged | +Inquiry |
FAM122B-4509HF | Recombinant Full Length Human FAM122B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122B-6442HCL | Recombinant Human FAM122B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM122B Products
Required fields are marked with *
My Review for All FAM122B Products
Required fields are marked with *
0
Inquiry Basket