Recombinant Human FAM122B Protein, GST-tagged
Cat.No. : | FAM122B-3690H |
Product Overview : | Human FAM122B full-length ORF ( NP_660327.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM122B (Family With Sequence Similarity 122B) is a Protein Coding gene. An important paralog of this gene is FAM122A. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVPSPRRFSSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM122B family with sequence similarity 122B [ Homo sapiens ] |
Official Symbol | FAM122B |
Synonyms | FAM122B; family with sequence similarity 122B; protein FAM122B; DKFZp686L20116; RP11 308B5.5; synoviocyte proliferation associated in collagen-induced arthritis 2; SPACIA2; RP11-308B5.5; MGC131814; |
Gene ID | 159090 |
mRNA Refseq | NM_001166599 |
Protein Refseq | NP_001160071 |
UniProt ID | Q7Z309 |
◆ Recombinant Proteins | ||
FAM122B-912Z | Recombinant Zebrafish FAM122B | +Inquiry |
FAM122B-3544H | Recombinant Human FAM122B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM122B-4509HF | Recombinant Full Length Human FAM122B Protein, GST-tagged | +Inquiry |
FAM122B-3690H | Recombinant Human FAM122B Protein, GST-tagged | +Inquiry |
FAM122B-3616H | Recombinant Human FAM122B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM122B-6442HCL | Recombinant Human FAM122B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM122B Products
Required fields are marked with *
My Review for All FAM122B Products
Required fields are marked with *