Recombinant Human FAM122B Protein, GST-tagged

Cat.No. : FAM122B-3690H
Product Overview : Human FAM122B full-length ORF ( NP_660327.2, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM122B (Family With Sequence Similarity 122B) is a Protein Coding gene. An important paralog of this gene is FAM122A.
Molecular Mass : 53.4 kDa
AA Sequence : MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVPSPRRFSSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM122B family with sequence similarity 122B [ Homo sapiens ]
Official Symbol FAM122B
Synonyms FAM122B; family with sequence similarity 122B; protein FAM122B; DKFZp686L20116; RP11 308B5.5; synoviocyte proliferation associated in collagen-induced arthritis 2; SPACIA2; RP11-308B5.5; MGC131814;
Gene ID 159090
mRNA Refseq NM_001166599
Protein Refseq NP_001160071
UniProt ID Q7Z309

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM122B Products

Required fields are marked with *

My Review for All FAM122B Products

Required fields are marked with *

0
cart-icon