Recombinant Human FAM124A Protein, GST-tagged

Cat.No. : FAM124A-3692H
Product Overview : Human FAM124A full-length ORF ( AAH34497.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM124A (Family With Sequence Similarity 124 Member A) is a Protein Coding gene. An important paralog of this gene is FAM124B.
Molecular Mass : 59 kDa
AA Sequence : MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLAWIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRFLPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPIFSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSLSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM124A family with sequence similarity 124A [ Homo sapiens ]
Official Symbol FAM124A
Synonyms FAM124A; family with sequence similarity 124A; protein FAM124A; FLJ30707; FLJ32081;
Gene ID 220108
mRNA Refseq NM_001242312
Protein Refseq NP_001229241
UniProt ID Q86V42

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM124A Products

Required fields are marked with *

My Review for All FAM124A Products

Required fields are marked with *

0
cart-icon