Recombinant Human FAM124A Protein, GST-tagged
Cat.No. : | FAM124A-3692H |
Product Overview : | Human FAM124A full-length ORF ( AAH34497.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM124A (Family With Sequence Similarity 124 Member A) is a Protein Coding gene. An important paralog of this gene is FAM124B. |
Molecular Mass : | 59 kDa |
AA Sequence : | MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLAWIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRFLPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPIFSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSLSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM124A family with sequence similarity 124A [ Homo sapiens ] |
Official Symbol | FAM124A |
Synonyms | FAM124A; family with sequence similarity 124A; protein FAM124A; FLJ30707; FLJ32081; |
Gene ID | 220108 |
mRNA Refseq | NM_001242312 |
Protein Refseq | NP_001229241 |
UniProt ID | Q86V42 |
◆ Recombinant Proteins | ||
FAM124A-3692H | Recombinant Human FAM124A Protein, GST-tagged | +Inquiry |
FAM124A-4512HF | Recombinant Full Length Human FAM124A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM124A-6440HCL | Recombinant Human FAM124A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM124A Products
Required fields are marked with *
My Review for All FAM124A Products
Required fields are marked with *
0
Inquiry Basket