Recombinant Human FAM168A Protein, GST-tagged
| Cat.No. : | FAM168A-3722H |
| Product Overview : | Human FAM168A full-length ORF (BAF84743.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM168A (Family With Sequence Similarity 168 Member A) is a Protein Coding gene. Diseases associated with FAM168A include Tongue Cancer and Oral Squamous Cell Carcinoma. An important paralog of this gene is FAM168B. |
| Molecular Mass : | 52.25 kDa |
| AA Sequence : | MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFRYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSAYPQQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPAPVAAPRTNGVAMGMVAGTTMAMSAGTLLTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM168A family with sequence similarity 168, member A [ Homo sapiens ] |
| Official Symbol | FAM168A |
| Synonyms | FAM168A; family with sequence similarity 168, member A; KIAA0280; protein FAM168A; TCRP1; tongue cancer chemotherapy resistance associated protein 1; tongue cancer chemotherapy resistance-associated protein 1; |
| Gene ID | 23201 |
| mRNA Refseq | NM_015159 |
| Protein Refseq | NP_055974 |
| MIM | 616316 |
| UniProt ID | Q92567 |
| ◆ Recombinant Proteins | ||
| FAM168A-1409R | Recombinant Rhesus Macaque FAM168A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM168A-4411Z | Recombinant Zebrafish FAM168A | +Inquiry |
| FAM168A-8066Z | Recombinant Zebrafish FAM168A | +Inquiry |
| FAM168A-1585R | Recombinant Rhesus monkey FAM168A Protein, His-tagged | +Inquiry |
| FAM168A-3722H | Recombinant Human FAM168A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM168A-6409HCL | Recombinant Human FAM168A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM168A Products
Required fields are marked with *
My Review for All FAM168A Products
Required fields are marked with *
