Recombinant Human FAM169B Protein, GST-tagged
Cat.No. : | FAM169B-4333H |
Product Overview : | Human FLJ39743 full-length ORF ( AAI48844.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM169B (Family With Sequence Similarity 169 Member B) is a Protein Coding gene. An important paralog of this gene is FAM169A. |
Molecular Mass : | 48.07 kDa |
AA Sequence : | MKVQSFGERVVLFILNAIIFGRLERNLDDDDMFFLPHSVKEQAKILWRRGAAVGFYTTKMKGRLCGDGTGACYLLPVFDTVFIRRKHWHRGLGTAMLRDFCETFPEDEALGVSCSMSPAMYQAHPGNSEDVSRHARTSQNDRPRQPAPGDGSKERMCGEELEDTKDDPECGVEEEDAGLAGQPPGKLTRSSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM169B family with sequence similarity 169 member B [ Homo sapiens (human) ] |
Official Symbol | FAM169B |
Synonyms | FAM169B; family with sequence similarity 169 member B; protein FAM169B |
Gene ID | 283777 |
mRNA Refseq | NM_182562 |
Protein Refseq | NP_872368 |
UniProt ID | Q8N8A8 |
◆ Recombinant Proteins | ||
FAM169B-4333H | Recombinant Human FAM169B Protein, GST-tagged | +Inquiry |
FAM169B-3008M | Recombinant Mouse FAM169B Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM169B-5526M | Recombinant Mouse FAM169B Protein | +Inquiry |
FAM169B-4904HF | Recombinant Full Length Human FAM169B Protein, GST-tagged | +Inquiry |
FAM169B-2907H | Recombinant Human FAM169B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM169B-650HCL | Recombinant Human FAM169B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM169B Products
Required fields are marked with *
My Review for All FAM169B Products
Required fields are marked with *
0
Inquiry Basket