Recombinant Human FAM169B Protein, GST-tagged

Cat.No. : FAM169B-4333H
Product Overview : Human FLJ39743 full-length ORF ( AAI48844.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM169B (Family With Sequence Similarity 169 Member B) is a Protein Coding gene. An important paralog of this gene is FAM169A.
Molecular Mass : 48.07 kDa
AA Sequence : MKVQSFGERVVLFILNAIIFGRLERNLDDDDMFFLPHSVKEQAKILWRRGAAVGFYTTKMKGRLCGDGTGACYLLPVFDTVFIRRKHWHRGLGTAMLRDFCETFPEDEALGVSCSMSPAMYQAHPGNSEDVSRHARTSQNDRPRQPAPGDGSKERMCGEELEDTKDDPECGVEEEDAGLAGQPPGKLTRSSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM169B family with sequence similarity 169 member B [ Homo sapiens (human) ]
Official Symbol FAM169B
Synonyms FAM169B; family with sequence similarity 169 member B; protein FAM169B
Gene ID 283777
mRNA Refseq NM_182562
Protein Refseq NP_872368
UniProt ID Q8N8A8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM169B Products

Required fields are marked with *

My Review for All FAM169B Products

Required fields are marked with *

0
cart-icon