Recombinant Human FAM176A protein, GST-tagged
Cat.No. : | FAM176A-1855H |
Product Overview : | Recombinant Human FAM176A protein(57-108 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 57-108 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM176A family with sequence similarity 176, member A [ Homo sapiens ] |
Official Symbol | FAM176A |
Synonyms | TMEM166 |
Gene ID | 84141 |
mRNA Refseq | NM_032181.2 |
Protein Refseq | NP_115557.1 |
UniProt ID | Q9H8M9 |
◆ Recombinant Proteins | ||
FAM176A-1855H | Recombinant Human FAM176A protein, GST-tagged | +Inquiry |
FAM176A-1590R | Recombinant Rhesus monkey FAM176A Protein, His-tagged | +Inquiry |
FAM176A-1414R | Recombinant Rhesus Macaque FAM176A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM176A-3018M | Recombinant Mouse FAM176A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM176A-5538M | Recombinant Mouse FAM176A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM176A Products
Required fields are marked with *
My Review for All FAM176A Products
Required fields are marked with *