Recombinant Human FAM177A1 Protein, His-tagged
| Cat.No. : | FAM177A1-20H |
| Product Overview : | Recombinant Human FAM177A1 Protein(Q8N128)(11-200 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-200 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 24 kDa |
| AASequence : | RGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEV |
| Storage : | Store at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| FAM177A1-6040Z | Recombinant Zebrafish FAM177A1 | +Inquiry |
| FAM177A1-20H | Recombinant Human FAM177A1 Protein, His-tagged | +Inquiry |
| FAM177A1-1591R | Recombinant Rhesus monkey FAM177A1 Protein, His-tagged | +Inquiry |
| FAM177A1-2865C | Recombinant Chicken FAM177A1 | +Inquiry |
| FAM177A1-1415R | Recombinant Rhesus Macaque FAM177A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM177A1-6401HCL | Recombinant Human FAM177A1 293 Cell Lysate | +Inquiry |
| FAM177A1-6402HCL | Recombinant Human FAM177A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM177A1 Products
Required fields are marked with *
My Review for All FAM177A1 Products
Required fields are marked with *
