Recombinant Human FAM177B Protein, GST-tagged

Cat.No. : FAM177B-3724H
Product Overview : Human FAM177B full-length ORF (BAC86182.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM177B (Family With Sequence Similarity 177 Member B) is a Protein Coding gene. An important paralog of this gene is FAM177A1.
Molecular Mass : 39.6 kDa
AA Sequence : MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFWAGRIASTSFSMLSLQATLLLKAEKEGLKQLLRSLSGCMEEFLMWVLVTLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM177B family with sequence similarity 177 member B [ Homo sapiens (human) ]
Official Symbol FAM177B
Synonyms FAM177B; family with sequence similarity 177 member B; Family With Sequence Similarity 177 Member B; Family With Sequence Similarity 177, Member B; protein FAM177B
Gene ID 400823
mRNA Refseq NM_001324080
Protein Refseq NP_001311009
UniProt ID A6PVY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM177B Products

Required fields are marked with *

My Review for All FAM177B Products

Required fields are marked with *

0
cart-icon
0
compare icon