Recombinant Human FAM177B Protein, GST-tagged
Cat.No. : | FAM177B-3724H |
Product Overview : | Human FAM177B full-length ORF (BAC86182.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM177B (Family With Sequence Similarity 177 Member B) is a Protein Coding gene. An important paralog of this gene is FAM177A1. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFWAGRIASTSFSMLSLQATLLLKAEKEGLKQLLRSLSGCMEEFLMWVLVTLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM177B family with sequence similarity 177 member B [ Homo sapiens (human) ] |
Official Symbol | FAM177B |
Synonyms | FAM177B; family with sequence similarity 177 member B; Family With Sequence Similarity 177 Member B; Family With Sequence Similarity 177, Member B; protein FAM177B |
Gene ID | 400823 |
mRNA Refseq | NM_001324080 |
Protein Refseq | NP_001311009 |
UniProt ID | A6PVY3 |
◆ Recombinant Proteins | ||
FAM177B-4537HF | Recombinant Full Length Human FAM177B Protein, GST-tagged | +Inquiry |
FAM177B-1295H | Recombinant Human FAM177B Protein, MYC/DDK-tagged | +Inquiry |
FAM177B-3724H | Recombinant Human FAM177B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM177B Products
Required fields are marked with *
My Review for All FAM177B Products
Required fields are marked with *