Recombinant Human FAM19A2 protein
Cat.No. : | FAM19A2-609H |
Product Overview : | Recombinant Human FAM19A2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 101 |
Description : | TAFA-2 also named FAM19A2, is a chemokinelike protein which is belonged to the FAM19/TAFA family. The family is a newly discovered and distantly related to MIP-1α. It contains 5 members and TAFA proteins are highly expressed in specific brain regions. Like other members of the TAFA family, with the exception of TAFA5, mature TAFA1 contains 10 regularly spaced cysteine residues. Human TAFA2 is 97 % a.a. identical to mouse TAFA2. The biological functions of TAFA family members remain to be determined, but they are postulated to act as brain-specific chemokines or neurokines that take parts in regulators of immune and nervous cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity is determined by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. rHuTAFA-2, immobilized at 6-24 μg/mL on a 96 well plate, is able to significantly enhance neurite outgrowth. |
Molecular Mass : | Approximately 11.2 kDa, a single, non-glycosylated polypeptide chain containing 101 amino acids. |
AA Sequence : | ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
Endotoxin : | Less than 1 EU/μg of rHuTAFA-2 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FAM19A2 |
Official Symbol | FAM19A2 |
Synonyms | FAM19A2; family with sequence similarity 19 (chemokine (C-C motif)-like), member A2; protein FAM19A2; TAFA 2; chemokine-like protein TAFA-2; TAFA2; TAFA-2; MGC42403; DKFZp761E1217; DKFZp781P0552; |
Gene ID | 338811 |
mRNA Refseq | NM_178539 |
Protein Refseq | NP_848634 |
MIM | 617496 |
UniProt ID | Q8N3H0 |
◆ Recombinant Proteins | ||
FAM19A2-971H | Recombinant Human FAM19A2 | +Inquiry |
Fam19a2-1565M | Recombinant Mouse Fam19a2 protein, His & T7-tagged | +Inquiry |
FAM19A2-7311H | Recombinant Human FAM19A2 protein, hFc-tagged | +Inquiry |
FAM19A2-3731H | Recombinant Human FAM19A2 Protein, GST-tagged | +Inquiry |
FAM19A2-4544HF | Recombinant Full Length Human FAM19A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A2-1465HCL | Recombinant Human FAM19A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM19A2 Products
Required fields are marked with *
My Review for All FAM19A2 Products
Required fields are marked with *
0
Inquiry Basket