Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human FAM20C, His-tagged

Cat.No. : FAM20C-26375TH
Product Overview : Recombinant fragment, corresponding to amino acids 509-570 of Human FAM20C with a N terminal His tag; predicted MWt 17kDa.
  • Specification
  • Gene Information
  • Related Products
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 112 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVE RDGLHSVVDDDLDTEHRAASAR
Sequence Similarities : Belongs to the FAM20 family.
Gene Name : FAM20C family with sequence similarity 20, member C [ Homo sapiens ]
Official Symbol : FAM20C
Synonyms : FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737;
Gene ID : 56975
mRNA Refseq : NM_020223
Protein Refseq : NP_064608
MIM : 611061
Uniprot ID : Q8IXL6
Chromosome Location : 7p22.3

Products Types

◆ Recombinant Protein
FAM20C-3048M Recombinant Mouse FAM20C Protein, His (Fc)-Avi-tagged +Inquiry
FAM20C-369H Recombinant Human FAM20C Protein, His-tagged +Inquiry
FAM20C-1427R Recombinant Rhesus Macaque FAM20C Protein, His (Fc)-Avi-tagged +Inquiry
FAM20C-1603R Recombinant Rhesus monkey FAM20C Protein, His-tagged +Inquiry
FAM20C-26H Recombinant Human FAM20C protein, His-tagged +Inquiry

See All FAM20C Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends