Recombinant Human FAM20C, His-tagged

• Cat.No.: FAM20C-26375TH
• Product Overview: Recombinant fragment, corresponding to amino acids 509-570 of Human FAM20C with a N terminal His tag; predicted MWt 17kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 509-570 a.a.
• Conjugation: HIS
• Tissue specificity: Widely expressed.
• Form: Lyophilised:Reconstitute with 112 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVE RDGLHSVVDDDLDTEHRAASAR
• Sequence Similarities: Belongs to the FAM20 family.

Gene Information

• Gene Name: FAM20C family with sequence similarity 20, member C [ Homo sapiens ]
• Official Symbol: FAM20C
• Synonyms: FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737
• Gene ID: 56975
• mRNA Refseq: NM_020223
• Protein Refseq: NP_064608
• MIM: 611061
• Uniprot ID: Q8IXL6
• Chromosome Location: 7p22.3