Recombinant Human FAM20C, His-tagged

Cat.No. : FAM20C-26375TH
Product Overview : Recombinant fragment, corresponding to amino acids 509-570 of Human FAM20C with a N terminal His tag; predicted MWt 17kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 509-570 a.a.
Conjugation : HIS
Tissue specificity : Widely expressed.
Form : Lyophilised:Reconstitute with 112 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVE RDGLHSVVDDDLDTEHRAASAR
Sequence Similarities : Belongs to the FAM20 family.
Gene Name FAM20C family with sequence similarity 20, member C [ Homo sapiens ]
Official Symbol FAM20C
Synonyms FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737;
Gene ID 56975
mRNA Refseq NM_020223
Protein Refseq NP_064608
MIM 611061
Uniprot ID Q8IXL6
Chromosome Location 7p22.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM20C Products

Required fields are marked with *

My Review for All FAM20C Products

Required fields are marked with *

0
cart-icon