Recombinant Human FAM219B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM219B-3274H |
Product Overview : | C15orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Metachondromatosis. An important paralog of this gene is FAM219A. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYSSAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ] |
Official Symbol | FAM219B |
Synonyms | FAM219B; family with sequence similarity 219 member B; C15orf17; protein FAM219B; uncharacterized protein C15orf17 |
Gene ID | 57184 |
mRNA Refseq | NM_020447 |
Protein Refseq | NP_065180 |
UniProt ID | Q5XKK7 |
◆ Recombinant Proteins | ||
FAM219B-3274H | Recombinant Human FAM219B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM219B-889H | Recombinant Human FAM219B Protein, His (Fc)-Avi-tagged | +Inquiry |
Fam219b-2930M | Recombinant Mouse Fam219b Protein, Myc/DDK-tagged | +Inquiry |
FAM219B-2275Z | Recombinant Zebrafish FAM219B | +Inquiry |
FAM219B-2179HFL | Recombinant Full Length Human FAM219B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM219B-8272HCL | Recombinant Human C15orf17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM219B Products
Required fields are marked with *
My Review for All FAM219B Products
Required fields are marked with *