Recombinant Human FAM219B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM219B-3274H
• Product Overview: C15orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Metachondromatosis. An important paralog of this gene is FAM219A.
• Molecular Mass: 21.1 kDa
• AA Sequence: MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYSSAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ]
• Official Symbol: FAM219B
• Synonyms: FAM219B; family with sequence similarity 219 member B; C15orf17; protein FAM219B; uncharacterized protein C15orf17
• Gene ID: 57184
• mRNA Refseq: NM_020447
• Protein Refseq: NP_065180
• UniProt ID: Q5XKK7