Recombinant Human FAM219B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM219B-3274H
Product Overview : C15orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM219B (Family With Sequence Similarity 219 Member B) is a Protein Coding gene. Diseases associated with FAM219B include Leopard Syndrome 1 and Metachondromatosis. An important paralog of this gene is FAM219A.
Molecular Mass : 21.1 kDa
AA Sequence : MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYSSAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM219B family with sequence similarity 219 member B [ Homo sapiens (human) ]
Official Symbol FAM219B
Synonyms FAM219B; family with sequence similarity 219 member B; C15orf17; protein FAM219B; uncharacterized protein C15orf17
Gene ID 57184
mRNA Refseq NM_020447
Protein Refseq NP_065180
UniProt ID Q5XKK7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM219B Products

Required fields are marked with *

My Review for All FAM219B Products

Required fields are marked with *

0
cart-icon
0
compare icon