Recombinant Human FAM221A Protein, GST-Tagged
Cat.No. : | FAM221A-0147H |
Product Overview : | Human C7orf46 full-length ORF (NP_954587.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B. |
Molecular Mass : | 59.5 kDa |
AA Sequence : | MERLTLPLGGAAAVDEYLEHRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKRFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIGVPSVEFLESPITAVDSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM221A family with sequence similarity 221, member A [ Homo sapiens ] |
Official Symbol | FAM221A |
Synonyms | C7orf46 |
Gene ID | 340277 |
mRNA Refseq | NM_199136 |
Protein Refseq | NP_954587 |
UniProt ID | A4D161 |
◆ Recombinant Proteins | ||
FAM221A-0147H | Recombinant Human FAM221A Protein, GST-Tagged | +Inquiry |
FAM221A-379H | Recombinant Human FAM221A Protein, MYC/DDK-tagged | +Inquiry |
FAM221A-1897R | Recombinant Rat FAM221A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM221A-2240R | Recombinant Rat FAM221A Protein | +Inquiry |
Fam221a-2931M | Recombinant Mouse Fam221a Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM221A Products
Required fields are marked with *
My Review for All FAM221A Products
Required fields are marked with *
0
Inquiry Basket