Recombinant Human FAM221A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM221A-3764H
• Product Overview: C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B.
• Molecular Mass: 29.2 kDa
• AA Sequence: MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM221A family with sequence similarity 221 member A [ Homo sapiens (human) ]
• Official Symbol: FAM221A
• Synonyms: FAM221A; family with sequence similarity 221 member A; C7orf46; protein FAM221A; uncharacterized protein C7orf46
• Gene ID: 340277
• mRNA Refseq: NM_001127364
• Protein Refseq: NP_001120836
• UniProt ID: A4D161