Recombinant Human FAM221A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM221A-3764H
Product Overview : C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B.
Molecular Mass : 29.2 kDa
AA Sequence : MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM221A family with sequence similarity 221 member A [ Homo sapiens (human) ]
Official Symbol FAM221A
Synonyms FAM221A; family with sequence similarity 221 member A; C7orf46; protein FAM221A; uncharacterized protein C7orf46
Gene ID 340277
mRNA Refseq NM_001127364
Protein Refseq NP_001120836
UniProt ID A4D161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM221A Products

Required fields are marked with *

My Review for All FAM221A Products

Required fields are marked with *

0
cart-icon