Recombinant Human FAM221A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FAM221A-3764H |
| Product Overview : | C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B. |
| Molecular Mass : | 29.2 kDa |
| AA Sequence : | MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FAM221A family with sequence similarity 221 member A [ Homo sapiens (human) ] |
| Official Symbol | FAM221A |
| Synonyms | FAM221A; family with sequence similarity 221 member A; C7orf46; protein FAM221A; uncharacterized protein C7orf46 |
| Gene ID | 340277 |
| mRNA Refseq | NM_001127364 |
| Protein Refseq | NP_001120836 |
| UniProt ID | A4D161 |
| ◆ Recombinant Proteins | ||
| FAM221A-379H | Recombinant Human FAM221A Protein, MYC/DDK-tagged | +Inquiry |
| FAM221A-1897R | Recombinant Rat FAM221A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM221A-2240R | Recombinant Rat FAM221A Protein | +Inquiry |
| FAM221A-2150Z | Recombinant Zebrafish FAM221A | +Inquiry |
| FAM221A-0147H | Recombinant Human FAM221A Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM221A Products
Required fields are marked with *
My Review for All FAM221A Products
Required fields are marked with *
