Recombinant Human FAM221A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM221A-3764H |
Product Overview : | C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM221A (Family With Sequence Similarity 221 Member A) is a Protein Coding gene. An important paralog of this gene is FAM221B. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFTCNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDSGIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM221A family with sequence similarity 221 member A [ Homo sapiens (human) ] |
Official Symbol | FAM221A |
Synonyms | FAM221A; family with sequence similarity 221 member A; C7orf46; protein FAM221A; uncharacterized protein C7orf46 |
Gene ID | 340277 |
mRNA Refseq | NM_001127364 |
Protein Refseq | NP_001120836 |
UniProt ID | A4D161 |
◆ Recombinant Proteins | ||
FAM221A-1897R | Recombinant Rat FAM221A Protein, His (Fc)-Avi-tagged | +Inquiry |
Fam221a-2931M | Recombinant Mouse Fam221a Protein, Myc/DDK-tagged | +Inquiry |
FAM221A-379H | Recombinant Human FAM221A Protein, MYC/DDK-tagged | +Inquiry |
FAM221A-2150Z | Recombinant Zebrafish FAM221A | +Inquiry |
FAM221A-3764H | Recombinant Human FAM221A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM221A Products
Required fields are marked with *
My Review for All FAM221A Products
Required fields are marked with *
0
Inquiry Basket