Recombinant Human FAM26E protein, His-tagged
Cat.No. : | FAM26E-2470H |
Product Overview : | Recombinant Human FAM26E protein(202-309 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 202-309 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RCRSKVSYLQLSFWKTYAQKEKEQLENTFLDYANKLSERNLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTMVLVGTAHNM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FAM26E family with sequence similarity 26, member E [ Homo sapiens ] |
Official Symbol | FAM26E |
Synonyms | C6orf188; dJ493F7.3 |
Gene ID | 254228 |
mRNA Refseq | NM_153711.2 |
Protein Refseq | NP_714922.1 |
UniProt ID | Q8N5C1 |
◆ Recombinant Proteins | ||
FAM26E-2244R | Recombinant Rat FAM26E Protein | +Inquiry |
FAM26E-3052M | Recombinant Mouse FAM26E Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM26E-1431R | Recombinant Rhesus Macaque FAM26E Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM26E-3531C | Recombinant Chicken FAM26E | +Inquiry |
FAM26E-1607R | Recombinant Rhesus monkey FAM26E Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM26E Products
Required fields are marked with *
My Review for All FAM26E Products
Required fields are marked with *
0
Inquiry Basket