Recombinant Human FAM38B protein, GST-tagged
Cat.No. : | FAM38B-301415H |
Product Overview : | Recombinant Human FAM38B (306-401 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Lys306-Asn401 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PIEZO2 piezo type mechanosensitive ion channel component 2 [ Homo sapiens (human) ] |
Official Symbol | FAM38B |
Synonyms | DA3; DA5; MWKS; DAIPT; PIEZO2; HsT748; HsT771; FAM38B2; C18orf30; C18orf58 |
Gene ID | 63895 |
mRNA Refseq | NM_001378183 |
Protein Refseq | NP_001365112 |
MIM | 613629 |
◆ Recombinant Proteins | ||
FAM38B-301415H | Recombinant Human FAM38B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM38B-6381HCL | Recombinant Human FAM38B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM38B Products
Required fields are marked with *
My Review for All FAM38B Products
Required fields are marked with *
0
Inquiry Basket