Recombinant Human FAM3B Protein, Fc-tagged
| Cat.No. : | FAM3B-750H |
| Product Overview : | Recombinant human FAM3B protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 235 |
| Description : | Involved in insulin secretion. Located in extracellular exosome. |
| Form : | Lyophilized |
| Molecular Mass : | 49.5 kDa |
| AA Sequence : | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | FAM3B family with sequence similarity 3, member B [ Homo sapiens (human) ] |
| Official Symbol | FAM3B |
| Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; |
| Gene ID | 54097 |
| mRNA Refseq | NM_058186 |
| Protein Refseq | NP_478066 |
| MIM | 608617 |
| UniProt ID | P58499 |
| ◆ Recombinant Proteins | ||
| Fam3b-4247M | Recombinant Mouse Fam3b protein, His&Myc-tagged | +Inquiry |
| FAM3B-319H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry |
| FAM3B-7846H | Recombinant Human FAM3B protein, His-tagged | +Inquiry |
| Fam3b-2938M | Recombinant Mouse Fam3b Protein, Myc/DDK-tagged | +Inquiry |
| FAM3B-4342H | Recombinant Human FAM3B protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *
