Recombinant Human FAM3B Protein, Fc-tagged

• Cat.No.: FAM3B-750H
• Product Overview: Recombinant human FAM3B protein with Fc tag was expressed in HEK293.

Specification

• Description: Involved in insulin secretion. Located in extracellular exosome.
• Source: HEK293
• Species: Human
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 49.5 kDa
• Protein length: 235
• AA Sequence: MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: FAM3B family with sequence similarity 3, member B [ Homo sapiens (human) ]
• Official Symbol: FAM3B
• Synonyms: FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11
• Gene ID: 54097
• mRNA Refseq: NM_058186
• Protein Refseq: NP_478066
• MIM: 608617
• UniProt ID: P58499