Recombinant Human FAM45A Protein, GST-tagged
Cat.No. : | FAM45A-3764H |
Product Overview : | Human FAM45A full-length ORF ( NP_996892.1, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM45A (Family With Sequence Similarity 45 Member A) is a Protein Coding gene. |
Molecular Mass : | 66.9 kDa |
AA Sequence : | MAAAEVADTQLMLGVGLIEKDTNGEVLWVWCYPSTTATLRNLLLRKCCLTDENKLLHPFVFGQYRRTWFYITTIEVPDSSILKKVTHFSIVLTAKDFNPEKYAAFTRILCRMYLKHGSPVKMMESYIAVLTKGICQSEENGSFLSKDFDARKAYLAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWTILHSYVHLNADELEALQMCTGYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKRFPPATENFLYHLAAAEQMLKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM45A family with sequence similarity 45, member A [ Homo sapiens ] |
Official Symbol | FAM45A |
Synonyms | FAM45A; family with sequence similarity 45, member A; Family With Sequence Similarity 45 Member A; Family With Sequence Similarity 45, Member A |
Gene ID | 404636 |
mRNA Refseq | NM_207009 |
Protein Refseq | NP_996892 |
UniProt ID | Q8TCE6 |
◆ Recombinant Proteins | ||
FAM45A-5596M | Recombinant Mouse FAM45A Protein | +Inquiry |
FAM45A-3764H | Recombinant Human FAM45A Protein, GST-tagged | +Inquiry |
FAM45A-2899C | Recombinant Chicken FAM45A | +Inquiry |
FAM45A-353H | Recombinant Human FAM45A Protein, MYC/DDK-tagged | +Inquiry |
FAM45A-4686HF | Recombinant Full Length Human FAM45A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM45A-6377HCL | Recombinant Human FAM45A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM45A Products
Required fields are marked with *
My Review for All FAM45A Products
Required fields are marked with *