Recombinant Human FAM60A Protein, GST-tagged
Cat.No. : | FAM60A-3785H |
Product Overview : | Human FAM60A full-length ORF ( NP_067061.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM60A (Family With Sequence Similarity 60 Member A) is a Protein Coding gene. |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM60A family with sequence similarity 60, member A [ Homo sapiens ] |
Official Symbol | FAM60A |
Synonyms | family with sequence similarity 60, member A; 30702; Ensembl:ENSG00000139146; protein FAM60A;tera protein homolog; L4; TERA; C12orf14 |
Gene ID | 58516 |
mRNA Refseq | NM_001135811 |
Protein Refseq | NP_001129283 |
MIM | 615027 |
UniProt ID | Q9NP50 |
◆ Recombinant Proteins | ||
FAM60A-3785H | Recombinant Human FAM60A Protein, GST-tagged | +Inquiry |
FAM60A-3074M | Recombinant Mouse FAM60A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM60A-2465C | Recombinant Chicken FAM60A | +Inquiry |
FAM60A-4623HF | Recombinant Full Length Human FAM60A Protein, GST-tagged | +Inquiry |
FAM60A-12715H | Recombinant Human FAM60A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM60A-6361HCL | Recombinant Human FAM60A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM60A Products
Required fields are marked with *
My Review for All FAM60A Products
Required fields are marked with *