Recombinant Human FAM72D Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM72D-3347H
• Product Overview: FAM72D MS Standard C13 and N15-labeled recombinant protein (NP_997301) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM72D (Family With Sequence Similarity 72 Member D) is a Protein Coding gene. An important paralog of this gene is FAM72C.
• Molecular Mass: 16.6 kDa
• AA Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM72D family with sequence similarity 72 member D [ Homo sapiens (human) ]
• Official Symbol: FAM72D
• Synonyms: FAM72D; family with sequence similarity 72 member D; GCUD2; protein FAM72D; gastric cancer up-regulated protein 2; gastric cancer up-regulated-2
• Gene ID: 728833
• mRNA Refseq: NM_207418
• Protein Refseq: NP_997301
• MIM: 614712
• UniProt ID: Q6L9T8