Recombinant Human FAM72D Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM72D-3347H |
Product Overview : | FAM72D MS Standard C13 and N15-labeled recombinant protein (NP_997301) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM72D (Family With Sequence Similarity 72 Member D) is a Protein Coding gene. An important paralog of this gene is FAM72C. |
Molecular Mass : | 16.6 kDa |
AA Sequence : | MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM72D family with sequence similarity 72 member D [ Homo sapiens (human) ] |
Official Symbol | FAM72D |
Synonyms | FAM72D; family with sequence similarity 72 member D; GCUD2; protein FAM72D; gastric cancer up-regulated protein 2; gastric cancer up-regulated-2 |
Gene ID | 728833 |
mRNA Refseq | NM_207418 |
Protein Refseq | NP_997301 |
MIM | 614712 |
UniProt ID | Q6L9T8 |
◆ Recombinant Proteins | ||
FAM72D-3347H | Recombinant Human FAM72D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM72D-335H | Recombinant Human FAM72D Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM72D-6352HCL | Recombinant Human FAM72D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM72D Products
Required fields are marked with *
My Review for All FAM72D Products
Required fields are marked with *
0
Inquiry Basket