Recombinant Human FAM76A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FAM76A-2367H |
Product Overview : | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B. |
Molecular Mass : | 35 kDa |
AA Sequence : | MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FAM76A family with sequence similarity 76 member A [ Homo sapiens (human) ] |
Official Symbol | FAM76A |
Synonyms | FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946; |
Gene ID | 199870 |
mRNA Refseq | NM_152660 |
Protein Refseq | NP_689873 |
UniProt ID | Q8TAV0 |
◆ Recombinant Proteins | ||
FAM76A-12725H | Recombinant Human FAM76A, GST-tagged | +Inquiry |
FAM76A-3090M | Recombinant Mouse FAM76A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM76A-340H | Recombinant Human FAM76A Protein, MYC/DDK-tagged | +Inquiry |
FAM76A-3028C | Recombinant Chicken FAM76A | +Inquiry |
FAM76A-3800H | Recombinant Human FAM76A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM76A-6350HCL | Recombinant Human FAM76A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM76A Products
Required fields are marked with *
My Review for All FAM76A Products
Required fields are marked with *
0
Inquiry Basket