Recombinant Human FAM76A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM76A-2367H
• Product Overview: FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B.
• Molecular Mass: 35 kDa
• AA Sequence: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM76A family with sequence similarity 76 member A [ Homo sapiens (human) ]
• Official Symbol: FAM76A
• Synonyms: FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946
• Gene ID: 199870
• mRNA Refseq: NM_152660
• Protein Refseq: NP_689873
• UniProt ID: Q8TAV0