Recombinant Full Length Human FAM76A Protein, GST-tagged

Cat.No. : FAM76A-4638HF
Product Overview : Human FAM76A full-length ORF ( NP_689873.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 307 amino acids
Description : FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B.
Molecular Mass : 61.4 kDa
AA Sequence : MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM76A family with sequence similarity 76, member A [ Homo sapiens ]
Official Symbol FAM76A
Synonyms FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946;
Gene ID 199870
mRNA Refseq NM_001143912
Protein Refseq NP_001137384
UniProt ID Q8TAV0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM76A Products

Required fields are marked with *

My Review for All FAM76A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon