Recombinant Full Length Human FAM76A Protein, GST-tagged
Cat.No. : | FAM76A-4638HF |
Product Overview : | Human FAM76A full-length ORF ( NP_689873.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 307 amino acids |
Description : | FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B. |
Molecular Mass : | 61.4 kDa |
AA Sequence : | MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM76A family with sequence similarity 76, member A [ Homo sapiens ] |
Official Symbol | FAM76A |
Synonyms | FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946; |
Gene ID | 199870 |
mRNA Refseq | NM_001143912 |
Protein Refseq | NP_001137384 |
UniProt ID | Q8TAV0 |
◆ Recombinant Proteins | ||
FAM76A-340H | Recombinant Human FAM76A Protein, MYC/DDK-tagged | +Inquiry |
FAM76A-3028C | Recombinant Chicken FAM76A | +Inquiry |
FAM76A-3090M | Recombinant Mouse FAM76A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM76A-4638HF | Recombinant Full Length Human FAM76A Protein, GST-tagged | +Inquiry |
Fam76a-2945M | Recombinant Mouse Fam76a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM76A-6350HCL | Recombinant Human FAM76A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM76A Products
Required fields are marked with *
My Review for All FAM76A Products
Required fields are marked with *
0
Inquiry Basket