Recombinant Human FAM84A protein, GST-tagged

• Cat.No.: FAM84A-301161H
• Product Overview: Recombinant Human FAM84A (1-132 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Gln132
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FAM84A family with sequence similarity 84, member A [ Homo sapiens ]
• Official Symbol: FAM84A
• Synonyms: FAM84A; family with sequence similarity 84, member A; protein FAM84A; FLJ35392; neurological/sensory 1; NSE1; neurologic sensory protein 1; PP11517
• Gene ID: 151354
• mRNA Refseq: NM_145175
• Protein Refseq: NP_660158
• MIM: 611234
• UniProt ID: Q96KN4