Recombinant Human FAM84A protein, GST-tagged
| Cat.No. : | FAM84A-301161H |
| Product Overview : | Recombinant Human FAM84A (1-132 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Gln132 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | FAM84A family with sequence similarity 84, member A [ Homo sapiens ] |
| Official Symbol | FAM84A |
| Synonyms | FAM84A; family with sequence similarity 84, member A; protein FAM84A; FLJ35392; neurological/sensory 1; NSE1; neurologic sensory protein 1; PP11517; |
| Gene ID | 151354 |
| mRNA Refseq | NM_145175 |
| Protein Refseq | NP_660158 |
| MIM | 611234 |
| UniProt ID | Q96KN4 |
| ◆ Recombinant Proteins | ||
| FAM84A-10893Z | Recombinant Zebrafish FAM84A | +Inquiry |
| FAM84A-1458R | Recombinant Rhesus Macaque FAM84A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM84A-5655M | Recombinant Mouse FAM84A Protein | +Inquiry |
| FAM84A-3102M | Recombinant Mouse FAM84A Protein, His (Fc)-Avi-tagged | +Inquiry |
| FAM84A-301161H | Recombinant Human FAM84A protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM84A-6343HCL | Recombinant Human FAM84A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM84A Products
Required fields are marked with *
My Review for All FAM84A Products
Required fields are marked with *
