Recombinant Human FAM84A protein, GST-tagged

Cat.No. : FAM84A-301161H
Product Overview : Recombinant Human FAM84A (1-132 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Gln132
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name FAM84A family with sequence similarity 84, member A [ Homo sapiens ]
Official Symbol FAM84A
Synonyms FAM84A; family with sequence similarity 84, member A; protein FAM84A; FLJ35392; neurological/sensory 1; NSE1; neurologic sensory protein 1; PP11517;
Gene ID 151354
mRNA Refseq NM_145175
Protein Refseq NP_660158
MIM 611234
UniProt ID Q96KN4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM84A Products

Required fields are marked with *

My Review for All FAM84A Products

Required fields are marked with *

0
cart-icon
0
compare icon