Recombinant Human FAM98A protein, His-tagged
| Cat.No. : | FAM98A-30H |
| Product Overview : | Recombinant Human FAM98A protein(Q8NCA5)(Gln251-Arg400), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gln251-Arg400 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20°C to -80°C. |
| Molecular Mass : | 17 kDa |
| AA Sequence : | QPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYR |
| Official Symbol | FAM98A |
| Synonyms | FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192; |
| Gene ID | 25940 |
| mRNA Refseq | NM_015475 |
| Protein Refseq | NP_056290 |
| UniProt ID | Q8NCA5 |
| ◆ Recombinant Proteins | ||
| FAM98A-2268R | Recombinant Rat FAM98A Protein | +Inquiry |
| FAM98A-1640R | Recombinant Rhesus monkey FAM98A Protein, His-tagged | +Inquiry |
| FAM98A-2737C | Recombinant Chicken FAM98A | +Inquiry |
| FAM98A-3817H | Recombinant Human FAM98A Protein, GST-tagged | +Inquiry |
| FAM98A-4656HF | Recombinant Full Length Human FAM98A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM98A-591HCL | Recombinant Human FAM98A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM98A Products
Required fields are marked with *
My Review for All FAM98A Products
Required fields are marked with *
Recently Viewed
