Recombinant Human FAM98A protein, His-tagged

Cat.No. : FAM98A-30H
Product Overview : Recombinant Human FAM98A protein(Q8NCA5)(Gln251-Arg400), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gln251-Arg400
Form : Phosphate buffered saline
Storage : Store at -20°C to -80°C.
Molecular Mass : 17 kDa
AA Sequence : QPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYR
Official Symbol FAM98A
Synonyms FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192;
Gene ID 25940
mRNA Refseq NM_015475
Protein Refseq NP_056290
UniProt ID Q8NCA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM98A Products

Required fields are marked with *

My Review for All FAM98A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon