Recombinant Human FAM98A protein, His-tagged
Cat.No. : | FAM98A-30H |
Product Overview : | Recombinant Human FAM98A protein(Q8NCA5)(Gln251-Arg400), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gln251-Arg400 |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C to -80°C. |
Molecular Mass : | 17 kDa |
AA Sequence : | QPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYR |
Official Symbol | FAM98A |
Synonyms | FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192; |
Gene ID | 25940 |
mRNA Refseq | NM_015475 |
Protein Refseq | NP_056290 |
UniProt ID | Q8NCA5 |
◆ Recombinant Proteins | ||
FAM98A-4656HF | Recombinant Full Length Human FAM98A Protein, GST-tagged | +Inquiry |
FAM98A-1464R | Recombinant Rhesus Macaque FAM98A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM98A-1925R | Recombinant Rat FAM98A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM98A-3817H | Recombinant Human FAM98A Protein, GST-tagged | +Inquiry |
FAM98A-30H | Recombinant Human FAM98A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM98A-591HCL | Recombinant Human FAM98A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM98A Products
Required fields are marked with *
My Review for All FAM98A Products
Required fields are marked with *
0
Inquiry Basket