Recombinant Human FAM98A Protein, GST-tagged

Cat.No. : FAM98A-3817H
Product Overview : Human FAM98A full-length ORF (BAC11255.1, 1 a.a. - 519 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM98A (Family With Sequence Similarity 98 Member A) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FAM98B.
Molecular Mass : 81.8 kDa
AA Sequence : MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQGGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM98A family with sequence similarity 98, member A [ Homo sapiens ]
Official Symbol FAM98A
Synonyms FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192;
Gene ID 25940
mRNA Refseq NM_015475
Protein Refseq NP_056290
UniProt ID Q8NCA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM98A Products

Required fields are marked with *

My Review for All FAM98A Products

Required fields are marked with *

0
cart-icon
0
compare icon