Recombinant Human FAM98A Protein, GST-tagged
Cat.No. : | FAM98A-3817H |
Product Overview : | Human FAM98A full-length ORF (BAC11255.1, 1 a.a. - 519 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAM98A (Family With Sequence Similarity 98 Member A) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is FAM98B. |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQGGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM98A family with sequence similarity 98, member A [ Homo sapiens ] |
Official Symbol | FAM98A |
Synonyms | FAM98A; family with sequence similarity 98, member A; protein FAM98A; DKFZP564F0522; DKFZp564F0522; DKFZp686O03192; |
Gene ID | 25940 |
mRNA Refseq | NM_015475 |
Protein Refseq | NP_056290 |
UniProt ID | Q8NCA5 |
◆ Recombinant Proteins | ||
FAM98A-1464R | Recombinant Rhesus Macaque FAM98A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM98A-1640R | Recombinant Rhesus monkey FAM98A Protein, His-tagged | +Inquiry |
FAM98A-3817H | Recombinant Human FAM98A Protein, GST-tagged | +Inquiry |
FAM98A-2737C | Recombinant Chicken FAM98A | +Inquiry |
FAM98A-1925R | Recombinant Rat FAM98A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM98A-591HCL | Recombinant Human FAM98A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM98A Products
Required fields are marked with *
My Review for All FAM98A Products
Required fields are marked with *
0
Inquiry Basket