Recombinant Human FANCF

Cat.No. : FANCF-28386TH
Product Overview : Recombinant fragment of Human FANCF with N-terminal proprietary tag. Predicted MW 35.64kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 91 amino acids
Description : The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F.
Molecular Weight : 35.640kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV
Gene Name FANCF Fanconi anemia, complementation group F [ Homo sapiens ]
Official Symbol FANCF
Synonyms FANCF; Fanconi anemia, complementation group F; Fanconi anemia group F protein; FAF;
Gene ID 2188
mRNA Refseq NM_022725
Protein Refseq NP_073562
MIM 613897
Uniprot ID Q9NPI8
Chromosome Location 11p15
Pathway BARD1 signaling events, organism-specific biosystem; DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function molecular_function; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FANCF Products

Required fields are marked with *

My Review for All FANCF Products

Required fields are marked with *

0
cart-icon
0
compare icon