Recombinant Human FANCF
| Cat.No. : | FANCF-28386TH |
| Product Overview : | Recombinant fragment of Human FANCF with N-terminal proprietary tag. Predicted MW 35.64kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 91 amino acids |
| Description : | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F. |
| Molecular Weight : | 35.640kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV |
| Gene Name | FANCF Fanconi anemia, complementation group F [ Homo sapiens ] |
| Official Symbol | FANCF |
| Synonyms | FANCF; Fanconi anemia, complementation group F; Fanconi anemia group F protein; FAF; |
| Gene ID | 2188 |
| mRNA Refseq | NM_022725 |
| Protein Refseq | NP_073562 |
| MIM | 613897 |
| Uniprot ID | Q9NPI8 |
| Chromosome Location | 11p15 |
| Pathway | BARD1 signaling events, organism-specific biosystem; DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; |
| Function | molecular_function; protein binding; |
| ◆ Recombinant Proteins | ||
| FANCF-28386TH | Recombinant Human FANCF | +Inquiry |
| FANCF-3831H | Recombinant Human FANCF Protein, GST-tagged | +Inquiry |
| FANCF-4248Z | Recombinant Zebrafish FANCF | +Inquiry |
| FANCF-4666HF | Recombinant Full Length Human FANCF Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FANCF-6332HCL | Recombinant Human FANCF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FANCF Products
Required fields are marked with *
My Review for All FANCF Products
Required fields are marked with *
