Recombinant Human FASLG protein(141-280 aa), N-SUMO & N-His-tagged
Cat.No. : | FASLG-2768H |
Product Overview : | Recombinant Human FASLG protein(P48023)(141-280 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&SUMO |
Protein Length : | 141-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK |
Gene Name | FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ] |
Official Symbol | FASLG |
Synonyms | FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
Gene ID | 356 |
mRNA Refseq | NM_000639 |
Protein Refseq | NP_000630 |
MIM | 134638 |
UniProt ID | P48023 |
◆ Recombinant Proteins | ||
FASLG-3201C | Recombinant Chicken FASLG | +Inquiry |
RFL23962MF | Recombinant Full Length Macaca Fascicularis Tumor Necrosis Factor Ligand Superfamily Member 6(Faslg) Protein, His-Tagged | +Inquiry |
FASLG-627R | Recombinant Rhesus monkey FASLG protein, His & T7-tagged | +Inquiry |
FASLG-2274R | Recombinant Rat FASLG Protein | +Inquiry |
FASLG-624H | Recombinant Human FASLG protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *