Recombinant Human FASLG protein, His-tagged
Cat.No. : | FASLG-2884H |
Product Overview : | Recombinant Human FASLG protein(P48023)(103-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 103-281aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ] |
Official Symbol | FASLG |
Synonyms | FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
Gene ID | 356 |
mRNA Refseq | NM_000639 |
Protein Refseq | NP_000630 |
MIM | 134638 |
UniProt ID | P48023 |
◆ Recombinant Proteins | ||
FASLG-10553M | Recombinant Mouse FASLG Protein, His (Fc)-Avi-tagged | +Inquiry |
Fasl-1736M | Recombinant Mouse Fas Ligand (TNF Superfamily, Member 6) | +Inquiry |
FASLG-624H | Recombinant Human FASLG protein, His & S-tagged | +Inquiry |
FASLG-166H | Active Recombinant Human FASLG Protein (Gln130-Leu281), N-His-SUMO tagged, Animal-free, Carrier-free | +Inquiry |
FASLG-065H | Recombinant Human FASLG Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *