Recombinant Human FASLG protein, His-tagged

Cat.No. : FASLG-2884H
Product Overview : Recombinant Human FASLG protein(P48023)(103-281aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 103-281aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.4 kDa
AA Sequence : QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ]
Official Symbol FASLG
Synonyms FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1;
Gene ID 356
mRNA Refseq NM_000639
Protein Refseq NP_000630
MIM 134638
UniProt ID P48023

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FASLG Products

Required fields are marked with *

My Review for All FASLG Products

Required fields are marked with *

0
cart-icon