Recombinant Human FASTKD3 protein, His-tagged
Cat.No. : | FASTKD3-6743H |
Product Overview : | Recombinant Human FASTKD3 protein(201-550 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201-550 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | PLIIKLGKYVVRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVAAVCLTLDPEVVCRVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNYLPPNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKPLFLQRLQGKESHLDTLSRAQLTQLFLASVLECPFYKGPKLLPKYQVKSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYFAPKVLTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWLQE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | FASTKD3 |
Synonyms | FASTKD3; FAST kinase domains 3; FAST kinase domain-containing protein 3; FLJ23274; MGC5297; MGC142123; |
Gene ID | 79072 |
mRNA Refseq | NM_024091 |
Protein Refseq | NP_076996 |
UniProt ID | Q14CZ7 |
◆ Recombinant Proteins | ||
FASTKD3-1934R | Recombinant Rat FASTKD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FASTKD3-4868HF | Recombinant Full Length Human FASTKD3 Protein, GST-tagged | +Inquiry |
FASTKD3-3124M | Recombinant Mouse FASTKD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FASTKD3-2277R | Recombinant Rat FASTKD3 Protein | +Inquiry |
FASTKD3-3862H | Recombinant Human FASTKD3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASTKD3 Products
Required fields are marked with *
My Review for All FASTKD3 Products
Required fields are marked with *
0
Inquiry Basket