Recombinant Human FATE1 Protein, GST-tagged

Cat.No. : FATE1-3864H
Product Overview : Human FATE1 full-length ORF (BAB71454.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010]
Molecular Mass : 47.1 kDa
AA Sequence : MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FATE1 fetal and adult testis expressed 1 [ Homo sapiens ]
Official Symbol FATE1
Synonyms FATE1; fetal and adult testis expressed 1; fetal and adult testis-expressed transcript protein; cancer/testis antigen 43; CT43; FATE; BJ-HCC-2 antigen; tumor antigen BJ-HCC-2; fetal and adult testis expressed transcript protein;
Gene ID 89885
mRNA Refseq NM_033085
Protein Refseq NP_149076
MIM 300450
UniProt ID Q969F0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FATE1 Products

Required fields are marked with *

My Review for All FATE1 Products

Required fields are marked with *

0
cart-icon