Recombinant Full Length Human FATE1 Protein, GST-tagged
Cat.No. : | FATE1-4871HF |
Product Overview : | Human FATE1 full-length ORF (BAB71454.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 183 amino acids |
Description : | This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FATE1 fetal and adult testis expressed 1 [ Homo sapiens ] |
Official Symbol | FATE1 |
Synonyms | FATE1; fetal and adult testis expressed 1; fetal and adult testis-expressed transcript protein; cancer/testis antigen 43; CT43; FATE; BJ-HCC-2 antigen; tumor antigen BJ-HCC-2; fetal and adult testis expressed transcript protein; |
Gene ID | 89885 |
mRNA Refseq | NM_033085 |
Protein Refseq | NP_149076 |
MIM | 300450 |
UniProt ID | Q969F0 |
◆ Recombinant Proteins | ||
FATE1-1470R | Recombinant Rhesus Macaque FATE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FATE1-1646R | Recombinant Rhesus monkey FATE1 Protein, His-tagged | +Inquiry |
FATE1-3864H | Recombinant Human FATE1 Protein, GST-tagged | +Inquiry |
FATE1-4871HF | Recombinant Full Length Human FATE1 Protein, GST-tagged | +Inquiry |
FATE1-5257H | Recombinant Human FATE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FATE1-6321HCL | Recombinant Human FATE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FATE1 Products
Required fields are marked with *
My Review for All FATE1 Products
Required fields are marked with *
0
Inquiry Basket