Recombinant Human FATE1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FATE1-5257H
Product Overview : FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation.
Molecular Mass : 20.7 kDa
AA Sequence : MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FATE1 fetal and adult testis expressed 1 [ Homo sapiens (human) ]
Official Symbol FATE1
Synonyms FATE1; fetal and adult testis expressed 1; fetal and adult testis-expressed transcript protein; cancer/testis antigen 43; CT43; FATE; BJ-HCC-2 antigen; tumor antigen BJ-HCC-2; fetal and adult testis expressed transcript protein;
Gene ID 89885
mRNA Refseq NM_033085
Protein Refseq NP_149076
MIM 300450
UniProt ID Q969F0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FATE1 Products

Required fields are marked with *

My Review for All FATE1 Products

Required fields are marked with *

0
cart-icon