Recombinant Human FATE1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FATE1-5257H
• Product Overview: FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation.
• Molecular Mass: 20.7 kDa
• AA Sequence: MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FATE1 fetal and adult testis expressed 1 [ Homo sapiens (human) ]
• Official Symbol: FATE1
• Synonyms: FATE1; fetal and adult testis expressed 1; fetal and adult testis-expressed transcript protein; cancer/testis antigen 43; CT43; FATE; BJ-HCC-2 antigen; tumor antigen BJ-HCC-2; fetal and adult testis expressed transcript protein
• Gene ID: 89885
• mRNA Refseq: NM_033085
• Protein Refseq: NP_149076
• MIM: 300450
• UniProt ID: Q969F0