Recombinant Human FAU
Cat.No. : | FAU-28808TH |
Product Overview : | Recombinant full length Human FAU with N-terminal proprietary tag, 40.37 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 133 amino acids |
Description : | This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. |
Molecular Weight : | 40.370kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQV VLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSL ARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV PTFGKKKGPNANS |
Sequence Similarities : | Belongs to the ubiquitin family. |
Gene Name | FAU Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed [ Homo sapiens ] |
Official Symbol | FAU |
Synonyms | FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); ubiquitin-like protein fubi and ribosomal protein S30; asr1; FLJ22986; Fub1; Fubi; |
Gene ID | 2197 |
mRNA Refseq | NM_001997 |
Protein Refseq | NP_001988 |
MIM | 134690 |
Uniprot ID | P35544 |
Chromosome Location | 11q13 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; |
Function | RNA binding; molecular_function; structural constituent of ribosome; |
◆ Recombinant Proteins | ||
FAU-262H | Recombinant Human FAU Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAU-3128M | Recombinant Mouse FAU Protein, His (Fc)-Avi-tagged | +Inquiry |
FAU-28808TH | Recombinant Human FAU | +Inquiry |
FAU-3866H | Recombinant Human FAU Protein, GST-tagged | +Inquiry |
FAU-1647R | Recombinant Rhesus monkey FAU Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAU Products
Required fields are marked with *
My Review for All FAU Products
Required fields are marked with *