Recombinant Mouse Fau protein, His&Myc-tagged
| Cat.No. : | Fau-733M |
| Product Overview : | Recombinant Mouse Fau protein(P35545)(1-74aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-74a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG |
| Gene Name | Fau Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) [ Mus musculus ] |
| Official Symbol | Fau |
| Synonyms | FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); 40S ribosomal protein S30; MNSF-beta; ubiquitin-like protein FUBI; monoclonal non-specific suppressor factor beta; monoclonal nonspecific suppressor factor betamonoclonal nonspecific suppressor factor beta; MNSFbeta; |
| Gene ID | 14109 |
| mRNA Refseq | NM_001160239 |
| Protein Refseq | NP_001153711 |
| ◆ Recombinant Proteins | ||
| Fau-733M | Recombinant Mouse Fau protein, His&Myc-tagged | +Inquiry |
| FAU-5696M | Recombinant Mouse FAU Protein | +Inquiry |
| FAU-3866H | Recombinant Human FAU Protein, GST-tagged | +Inquiry |
| FAU-163HF | Recombinant Full Length Human FAU Protein | +Inquiry |
| FAU-1647R | Recombinant Rhesus monkey FAU Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fau Products
Required fields are marked with *
My Review for All Fau Products
Required fields are marked with *



