Recombinant Human FAXDC2 Protein, GST-Tagged
Cat.No. : | FAXDC2-0090H |
Product Overview : | Human FAXDC2 full-length ORF (NP_115761.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FAXDC2 (Fatty Acid Hydroxylase Domain Containing 2) is a Protein Coding gene. Among its related pathways are cholesterol biosynthesis I and Metabolism. GO annotations related to this gene include oxidoreductase activity and iron ion binding. An important paralog of this gene is MSMO1. |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAXDC2 fatty acid hydroxylase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | FAXDC2 |
Synonyms | FAXDC2; fatty acid hydroxylase domain containing 2; C5ORF4; chromosome 5 open reading frame 4; uncharacterized protein C5orf4; FLJ13758; Fatty Acid Hydroxylase Domain Containing 2; Fatty Acid Hydroxylase Domain-Containing Protein 2; Chromosome 5 Open Reading Frame 4 |
Gene ID | 10826 |
mRNA Refseq | NM_032385 |
Protein Refseq | NP_115761 |
UniProt ID | Q96IV6 |
◆ Recombinant Proteins | ||
FAXDC2-260C | Recombinant Cynomolgus Monkey FAXDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAXDC2-1649R | Recombinant Rhesus monkey FAXDC2 Protein, His-tagged | +Inquiry |
FAXDC2-12669Z | Recombinant Zebrafish FAXDC2 | +Inquiry |
RFL32820HF | Recombinant Full Length Human Uncharacterized Protein C5Orf4(C5Orf4) Protein, His-Tagged | +Inquiry |
FAXDC2-515C | Recombinant Cynomolgus FAXDC2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAXDC2 Products
Required fields are marked with *
My Review for All FAXDC2 Products
Required fields are marked with *