Recombinant Human FAXDC2 Protein, GST-Tagged

• Cat.No.: FAXDC2-0090H
• Product Overview: Human FAXDC2 full-length ORF (NP_115761.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAXDC2 (Fatty Acid Hydroxylase Domain Containing 2) is a Protein Coding gene. Among its related pathways are cholesterol biosynthesis I and Metabolism. GO annotations related to this gene include oxidoreductase activity and iron ion binding. An important paralog of this gene is MSMO1.
• Molecular Mass: 49.2 kDa
• AA Sequence: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAXDC2 fatty acid hydroxylase domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: FAXDC2
• Synonyms: FAXDC2; fatty acid hydroxylase domain containing 2; C5ORF4; chromosome 5 open reading frame 4; uncharacterized protein C5orf4; FLJ13758; Fatty Acid Hydroxylase Domain Containing 2; Fatty Acid Hydroxylase Domain-Containing Protein 2; Chromosome 5 Open Reading Frame 4
• Gene ID: 10826
• mRNA Refseq: NM_032385
• Protein Refseq: NP_115761
• UniProt ID: Q96IV6